PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016663.1
Common NameLOC103959467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 245aa    MW: 28738.2 Da    PI: 8.4664
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016663.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll ++++ +G g W+ ++ + g++R++k+c+ rw++yl
      Pbr016663.1 12 KGAWTREEDNLLRQCIEIHGEGKWNQVSYKAGLNRCRKSCRQRWLNYL 59
                     79********************************************97 PP

2Myb_DNA-binding47.54.1e-1565108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg + ++E +l+++++++lG++ W++Iar+++ gRt++++k++w++
      Pbr016663.1  65 RGDFKEDEVDLILRLHRLLGNR-WSLIARRLP-GRTANDVKNYWNT 108
                      78999*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.249763IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-21962IPR009057Homeodomain-like
SuperFamilySSF466891.84E-289106IPR009057Homeodomain-like
SMARTSM007172.1E-151161IPR001005SANT/Myb domain
PfamPF002491.3E-151259IPR001005SANT/Myb domain
CDDcd001676.15E-101459No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2163110IPR009057Homeodomain-like
SMARTSM007171.1E-1364112IPR001005SANT/Myb domain
PROSITE profilePS5129418.08964114IPR017930Myb domain
PfamPF002491.0E-1365108IPR001005SANT/Myb domain
CDDcd001675.78E-968110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEGYNVNLSV RKGAWTREED NLLRQCIEIH GEGKWNQVSY KAGLNRCRKS CRQRWLNYLK  60
PNIKRGDFKE DEVDLILRLH RLLGNRWSLI ARRLPGRTAN DVKNYWNTRL GIDSRMKTLK  120
NKSQETRKTN VIRPQPQKFI KSSYYLSSKE PILEHIQSAE DLSTPSQTSS STKNGNDWWE  180
TLFEGEDTFE RAACPSIELE EELFTTFWFD DRLSARSCAN FPEEGQSRSE FSFSMDLWNH  240
SKEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-22121107104B-MYB
1h8a_C4e-22611021124MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF3875200.0KF387520.1 Pyrus x bretschneideri MYB transcription factor 10 (MYB10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370092.10.0PREDICTED: transcription factor MYB75-like
SwissprotQ9FNV92e-54MY113_ARATH; Transcription factor MYB113
TrEMBLB5STY70.0B5STY7_PYRPY; MYB35 protein
TrEMBLB5STY80.0B5STY8_9R
STRINGVIT_14s0006g01290.t011e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-55myb domain protein 113
Publications ? help Back to Top
  1. Lin-Wang K, et al.
    An R2R3 MYB transcription factor associated with regulation of the anthocyanin biosynthetic pathway in Rosaceae.
    BMC Plant Biol., 2010. 10: p. 50
    [PMID:20302676]